![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.7: Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A [89851] (2 proteins) automatically mapped to Pfam PF13474 automatically mapped to Pfam PF08332 |
![]() | Protein automated matches [190404] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187282] (5 PDB entries) |
![]() | Domain d2ux0f_: 2ux0 F: [152236] Other proteins in same PDB: d2ux0a1 automated match to d1hkxa_ complexed with gly |
PDB Entry: 2ux0 (more details), 2.46 Å
SCOPe Domain Sequences for d2ux0f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ux0f_ d.17.4.7 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]} tededlkvrkqeiikiteqlieainngdfeaytkicdpgltsfepealgnlvegmdfhkf yfenllsknskpihttilnphvhvigedaaciayirltqyidgqgrprtsqseetrvwhr rdgkwlnvhyhcsg
Timeline for d2ux0f_: