![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
![]() | Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) ![]() automatically mapped to Pfam PF00124 |
![]() | Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
![]() | Protein automated matches [190224] (17 species) not a true protein |
![]() | Species Rhodobacter sphaeroides [TaxId:1063] [186985] (34 PDB entries) |
![]() | Domain d2uwtm_: 2uwt M: [152224] Other proteins in same PDB: d2uwth1, d2uwth2 automated match to d1ystm_ complexed with bcl, bph, fe, gol, hto, lda, po4, spo, u10, uq2 |
PDB Entry: 2uwt (more details), 2.5 Å
SCOPe Domain Sequences for d2uwtm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uwtm_ f.26.1.1 (M:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]} aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn hgm
Timeline for d2uwtm_: