Domain d2uwtl_: 2uwt L:

Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)

Lineage for d2uwtl_ (2uwt L:)

Root: SCOP 1.75B
Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
five transmembrane helices forming a sheet-like structure
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 protein domains)
L and M are probably related to each other
Protein automated matches [190224] (5 species)
not a true protein
Species Rhodobacter sphaeroides [TaxId:1063] [186985] (29 PDB entries)
Domain d2uwtl_: 2uwt L: [152223]
automated match to d1aigl_
complexed with bcl, bph, fe, gol, hto, lda, po4, spo, u10, uq2

Details for d2uwtl_

PDB Entry: 2uwt (more details)
PDB Description: x-ray high resolution structure of the photosynthetic reaction center from rb. sphaeroides at ph 6.5 in the charge-separated state 2nd dataset
PDB Compounds: (L:) reaction center protein l chain

SCOP Domain Sequences for d2uwtl_:
Sequence; same for both SEQRES and ATOM records: (download)

>d2uwtl_ f.26.1.1 (L:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]} allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

SCOP Domain Coordinates for d2uwtl_:

Click to download the PDB-style file with coordinates for d2uwtl_.
(The format of our PDB-style files is described here.)

Timeline for d2uwtl_:
d2uwtl_ appears in SCOP 1.75A

d2uwtl_
(click for larger image)

d2uwtl_ in context of chain

d2uwtl_ in context of PDB
Domains from other chains:
d2uwtm_