Lineage for d2uwsl_ (2uws L:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1457799Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 1457800Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 1457801Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 1457967Protein automated matches [190224] (5 species)
    not a true protein
  7. 1457979Species Rhodobacter sphaeroides [TaxId:1063] [186985] (31 PDB entries)
  8. 1458035Domain d2uwsl_: 2uws L: [152221]
    Other proteins in same PDB: d2uwsh1, d2uwsh2
    automated match to d1aigl_
    complexed with bcl, bph, fe, gol, lda, po4, spo, u10, uq2

Details for d2uwsl_

PDB Entry: 2uws (more details), 2.9 Å

PDB Description: x-ray high resolution structure of the photosynthetic reaction center from rb. sphaeroides at ph 6.5 in the charge-separated state
PDB Compounds: (L:) reaction center protein l chain

SCOPe Domain Sequences for d2uwsl_:

Sequence, based on SEQRES records: (download)

>d2uwsl_ f.26.1.1 (L:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

Sequence, based on observed residues (ATOM records): (download)

>d2uwsl_ f.26.1.1 (L:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdedtffrdlvgysigtlgihrlglllslsav
ffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

SCOPe Domain Coordinates for d2uwsl_:

Click to download the PDB-style file with coordinates for d2uwsl_.
(The format of our PDB-style files is described here.)

Timeline for d2uwsl_: