| Class g: Small proteins [56992] (90 folds) |
| Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
Superfamily g.7.1: Snake toxin-like [57302] (4 families) ![]() |
| Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (7 proteins) |
| Protein automated matches [190308] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187126] (3 PDB entries) |
| Domain d2uwra_: 2uwr A: [152220] automated match to d1cdqa_ |
PDB Entry: 2uwr (more details), 1.34 Å
SCOPe Domain Sequences for d2uwra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uwra_ g.7.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mlqcyncpnptadcktavncssdfdaclitkaglqvynkcwkfehcnfndvttrlrenel
tyycckkdlcnfneqlenc
Timeline for d2uwra_: