Lineage for d2uwem2 (2uwe M:118-245)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749668Protein T-cell antigen receptor [49125] (7 species)
  7. 2749812Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (15 PDB entries)
  8. 2749819Domain d2uwem2: 2uwe M:118-245 [152219]
    Other proteins in same PDB: d2uwea1, d2uwea2, d2uweb2, d2uweb3, d2uwee1, d2uwef1, d2uweh1, d2uweh2, d2uwei2, d2uwei3, d2uwel1, d2uwem1
    automatically matched to d1lp9f2
    mutant

Details for d2uwem2

PDB Entry: 2uwe (more details), 2.4 Å

PDB Description: large cdr3a loop alteration as a function of mhc mutation
PDB Compounds: (M:) ahiii tcr beta chain

SCOPe Domain Sequences for d2uwem2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uwem2 b.1.1.2 (M:118-245) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
dlrnvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyalssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgra

SCOPe Domain Coordinates for d2uwem2:

Click to download the PDB-style file with coordinates for d2uwem2.
(The format of our PDB-style files is described here.)

Timeline for d2uwem2: