Lineage for d2uwel2 (2uwe L:118-198)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 935079Protein T-cell antigen receptor [49125] (6 species)
  7. 935160Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [49126] (11 PDB entries)
  8. 935164Domain d2uwel2: 2uwe L:118-198 [152217]
    Other proteins in same PDB: d2uwea1, d2uwea2, d2uweb_, d2uwee1, d2uwef1, d2uweh1, d2uweh2, d2uwei_, d2uwel1, d2uwem1
    automatically matched to d1lp9e2
    mutant

Details for d2uwel2

PDB Entry: 2uwe (more details), 2.4 Å

PDB Description: large cdr3a loop alteration as a function of mhc mutation
PDB Compounds: (L:) ahiii tcr alpha chain

SCOPe Domain Sequences for d2uwel2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uwel2 b.1.1.2 (L:118-198) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]}
iqnpepavyqlkdprsqdstlclftdfdsqinvpktmesgtfitdktvldmkamdsksng
aiawsnqtsftcqdifket

SCOPe Domain Coordinates for d2uwel2:

Click to download the PDB-style file with coordinates for d2uwel2.
(The format of our PDB-style files is described here.)

Timeline for d2uwel2: