Lineage for d2uwel2 (2uwe L:118-198)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 786831Protein T-cell antigen receptor [49125] (6 species)
  7. 786912Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [49126] (11 PDB entries)
  8. 786916Domain d2uwel2: 2uwe L:118-198 [152217]
    Other proteins in same PDB: d2uwea1, d2uwea2, d2uweb1, d2uwee1, d2uwef1, d2uweh1, d2uweh2, d2uwei1, d2uwel1, d2uwem1
    automatically matched to d1lp9e2
    mutant

Details for d2uwel2

PDB Entry: 2uwe (more details), 2.4 Å

PDB Description: large cdr3a loop alteration as a function of mhc mutation
PDB Compounds: (L:) ahiii tcr alpha chain

SCOP Domain Sequences for d2uwel2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uwel2 b.1.1.2 (L:118-198) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]}
iqnpepavyqlkdprsqdstlclftdfdsqinvpktmesgtfitdktvldmkamdsksng
aiawsnqtsftcqdifket

SCOP Domain Coordinates for d2uwel2:

Click to download the PDB-style file with coordinates for d2uwel2.
(The format of our PDB-style files is described here.)

Timeline for d2uwel2: