SCOP 1.75: Domain d2uwel1: 2uwe L:0-117

Lineage for d2uwel1 (2uwe L:0-117)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)
   sequences may differ within each classified species

7. Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (21 PDB entries)

8. Domain d2uwel1: 2uwe L:0-117 [152216]
   Other proteins in same PDB: d2uwea1, d2uwea2, d2uweb1, d2uwee2, d2uwef2, d2uweh1, d2uweh2, d2uwei1, d2uwel2, d2uwem2
   automatically matched to d1lp9e1
   mutant

Details for d2uwel1

PDB Entry: 2uwe, 2.4 Å

PDB Description: large cdr3a loop alteration as a function of mhc mutation

PDB Compounds: (L:) ahiii tcr alpha chain

SCOP Domain Sequences for d2uwel1:

Sequence; same for both SEQRES and ATOM records:

>d2uwel1 b.1.1.1 (L:0-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]}
mdsvtqteglvtlteglpvmlnctyqstyspflfwyvqhlneapklllksftdnkrpehq
gfhatlhkssssfhlqkssaqlsdsalyycalflasssfsklvfgqgtslsvvpn

Timeline for d2uwel1:

• d2uwel1 is new in SCOP 1.75
  
• d2uwel1 appears in SCOPe 2.01
  
• d2uwel1 appears in the current release, SCOPe 2.08