| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
| Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (22 PDB entries) |
| Domain d2uwel1: 2uwe L:0-117 [152216] Other proteins in same PDB: d2uwea1, d2uwea2, d2uweb2, d2uweb3, d2uwee2, d2uwef2, d2uweh1, d2uweh2, d2uwei2, d2uwei3, d2uwel2, d2uwem2 automatically matched to d1lp9e1 mutant |
PDB Entry: 2uwe (more details), 2.4 Å
SCOPe Domain Sequences for d2uwel1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uwel1 b.1.1.1 (L:0-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]}
mdsvtqteglvtlteglpvmlnctyqstyspflfwyvqhlneapklllksftdnkrpehq
gfhatlhkssssfhlqkssaqlsdsalyycalflasssfsklvfgqgtslsvvpn
Timeline for d2uwel1: