Lineage for d2uweh2 (2uwe H:1-181)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937656Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2937696Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (104 PDB entries)
    Uniprot P01892 25-298
  8. 2937793Domain d2uweh2: 2uwe H:1-181 [152214]
    Other proteins in same PDB: d2uwea1, d2uweb2, d2uweb3, d2uwee1, d2uwee2, d2uwef1, d2uwef2, d2uweh1, d2uwei2, d2uwei3, d2uwel1, d2uwel2, d2uwem1, d2uwem2
    automatically matched to d1akja2
    mutant

Details for d2uweh2

PDB Entry: 2uwe (more details), 2.4 Å

PDB Description: large cdr3a loop alteration as a function of mhc mutation
PDB Compounds: (H:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d2uweh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uweh2 d.19.1.1 (H:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegacvewlrrylengketlq
r

SCOPe Domain Coordinates for d2uweh2:

Click to download the PDB-style file with coordinates for d2uweh2.
(The format of our PDB-style files is described here.)

Timeline for d2uweh2: