| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein T-cell antigen receptor [49125] (7 species) |
| Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [49126] (11 PDB entries) |
| Domain d2uwee2: 2uwe E:118-198 [152210] Other proteins in same PDB: d2uwea1, d2uwea2, d2uweb2, d2uweb3, d2uwee1, d2uwef1, d2uweh1, d2uweh2, d2uwei2, d2uwei3, d2uwel1, d2uwem1 automatically matched to d1lp9e2 mutant |
PDB Entry: 2uwe (more details), 2.4 Å
SCOPe Domain Sequences for d2uwee2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uwee2 b.1.1.2 (E:118-198) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]}
iqnpepavyqlkdprsqdstlclftdfdsqinvpktmesgtfitdktvldmkamdsksng
aiawsnqtsftcqdifket
Timeline for d2uwee2: