Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species) |
Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (92 PDB entries) Uniprot P01892 25-298 |
Domain d2uwea2: 2uwe A:1-181 [152207] Other proteins in same PDB: d2uwea1, d2uweb_, d2uwee1, d2uwee2, d2uwef1, d2uwef2, d2uweh1, d2uwei_, d2uwel1, d2uwel2, d2uwem1, d2uwem2 automatically matched to d1akja2 mutant |
PDB Entry: 2uwe (more details), 2.4 Å
SCOPe Domain Sequences for d2uwea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uwea2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]} gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegacvewlrrylengketlq r
Timeline for d2uwea2: