SCOPe 2.08: Domain d2uwea2: 2uwe A:1-181

Lineage for d2uwea2 (2uwe A:1-181)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (104 PDB entries)
   Uniprot P01892 25-298

8. Domain d2uwea2: 2uwe A:1-181 [152207]
   Other proteins in same PDB: d2uwea1, d2uweb2, d2uweb3, d2uwee1, d2uwee2, d2uwef1, d2uwef2, d2uweh1, d2uwei2, d2uwei3, d2uwel1, d2uwel2, d2uwem1, d2uwem2
   automatically matched to d1akja2
   mutant

Details for d2uwea2

PDB Entry: 2uwe, 2.4 Å

PDB Description: large cdr3a loop alteration as a function of mhc mutation

PDB Compounds: (A:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d2uwea2:

Sequence; same for both SEQRES and ATOM records:

>d2uwea2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegacvewlrrylengketlq
r

Timeline for d2uwea2:

• d2uwea2 first appeared in SCOP 1.75
  
• d2uwea2 appears in SCOPe 2.07