Lineage for d2uwea1 (2uwe A:182-275)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2746844Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 2746845Species Human (Homo sapiens) [TaxId:9606] [88605] (203 PDB entries)
    Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor
  8. 2747008Domain d2uwea1: 2uwe A:182-275 [152206]
    Other proteins in same PDB: d2uwea2, d2uweb2, d2uweb3, d2uwee1, d2uwee2, d2uwef1, d2uwef2, d2uweh2, d2uwei2, d2uwei3, d2uwel1, d2uwel2, d2uwem1, d2uwem2
    automatically matched to d1akja1
    mutant

Details for d2uwea1

PDB Entry: 2uwe (more details), 2.4 Å

PDB Description: large cdr3a loop alteration as a function of mhc mutation
PDB Compounds: (A:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d2uwea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uwea1 b.1.1.2 (A:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

SCOPe Domain Coordinates for d2uwea1:

Click to download the PDB-style file with coordinates for d2uwea1.
(The format of our PDB-style files is described here.)

Timeline for d2uwea1: