Lineage for d2uw2a1 (2uw2 A:66-350)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1990025Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 protein domains)
  6. 1990178Protein Ribonucleotide reductase R2 [47257] (10 species)
  7. 1990260Species Human (Homo sapiens), RRM2 [TaxId:9606] [158401] (1 PDB entry)
    Uniprot P31350 66-350
  8. 1990261Domain d2uw2a1: 2uw2 A:66-350 [152205]
    complexed with fe

Details for d2uw2a1

PDB Entry: 2uw2 (more details), 2.8 Å

PDB Description: crystal structure of human ribonucleotide reductase subunit r2
PDB Compounds: (A:) ribonucleoside-diphosphate reductase m2 subunit

SCOPe Domain Sequences for d2uw2a1:

Sequence, based on SEQRES records: (download)

>d2uw2a1 a.25.1.2 (A:66-350) Ribonucleotide reductase R2 {Human (Homo sapiens), RRM2 [TaxId: 9606]}
gvedepllrenprrfvifpieyhdiwqmykkaeasfwtaeevdlskdiqhweslkpeery
fishvlaffaasdgivnenlverfsqevqitearcfygfqiamenihsemysllidtyik
dpkereflfnaietmpcvkkkadwalrwigdkeatygervvafaavegiffsgsfasifw
lkkrgpmpgltfsnelisrdeglhcdfaclmfkhlvhkpseervreiiinavrieqeflt
ealpvkligmnctlmkqyiefvadrlmlelgfskvfrvenpfdfm

Sequence, based on observed residues (ATOM records): (download)

>d2uw2a1 a.25.1.2 (A:66-350) Ribonucleotide reductase R2 {Human (Homo sapiens), RRM2 [TaxId: 9606]}
gvedepllrenpifpieyhdiwqmykkaeasfwtaeevdlskdiqhweslkpeeryfish
vlaffaasdgivnenlverfsqevqitearcfygfqiamenihsemysllidtyikdpke
reflmpcvkkkadwalrwigdkeatygervvafaavegiffsgsfasifwlkkrgpmpgl
tfsnelisrdeglhcdfaclmfkhlvhkpseervreiiinavrieqefltealpvkligm
nctlmkqyiefvadrlmlelgfskvfrvenpfdfm

SCOPe Domain Coordinates for d2uw2a1:

Click to download the PDB-style file with coordinates for d2uw2a1.
(The format of our PDB-style files is described here.)

Timeline for d2uw2a1: