Lineage for d2uvsa1 (2uvs A:1-38)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3030456Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. 3030578Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins)
  6. 3030642Protein Kaliotoxin (KTX) [57151] (2 species)
  7. 3030643Species Androctonus mauretanicus [TaxId:6859] [161119] (1 PDB entry)
  8. 3030644Domain d2uvsa1: 2uvs A:1-38 [152204]
    automatically matched to d1xswa1

Details for d2uvsa1

PDB Entry: 2uvs (more details)

PDB Description: high resolution solid-state nmr structure of kaliotoxin
PDB Compounds: (A:) potassium channel toxin alpha-ktx 3.1

SCOPe Domain Sequences for d2uvsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uvsa1 g.3.7.2 (A:1-38) Kaliotoxin (KTX) {Androctonus mauretanicus [TaxId: 6859]}
gveinvkcsgspqclkpckdagmrfgkcmnrkchctpk

SCOPe Domain Coordinates for d2uvsa1:

Click to download the PDB-style file with coordinates for d2uvsa1.
(The format of our PDB-style files is described here.)

Timeline for d2uvsa1: