Lineage for d2uv2a1 (2uv2 A:21-308)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2544896Protein STE20-like serine/threonine-protein kinase, SLK [160812] (1 species)
  7. 2544897Species Human (Homo sapiens) [TaxId:9606] [160813] (5 PDB entries)
    Uniprot Q9H2G2 21-308
  8. 2544900Domain d2uv2a1: 2uv2 A:21-308 [152203]
    complexed with edo, gvd, scn

Details for d2uv2a1

PDB Entry: 2uv2 (more details), 2.3 Å

PDB Description: crystal structure of human ste20-like kinase bound to 4-(4-(5- cyclopropyl-1h-pyrazol-3-ylamino)-quinazolin-2-ylamino)-phenyl)- acetonitrile
PDB Compounds: (A:) ste20-like serine-threonine kinase

SCOPe Domain Sequences for d2uv2a1:

Sequence, based on SEQRES records: (download)

>d2uv2a1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]}
yehvtrdlnpedfweiigelgdgafgkvykaqnketsvlaaakvidtkseeeledymvei
dilascdhpnivklldafyyennlwiliefcaggavdavmlelerpltesqiqvvckqtl
dalnylhdnkiihrdlkagnilftldgdikladfgvsakntrtiqrrdsfigtpywmape
vvmcetskdrpydykadvwslgitliemaeiepphhelnpmrvllkiaksepptlaqpsr
wssnfkdflkkcleknvdarwttsqllqhpfvtvdsnkpireliaeak

Sequence, based on observed residues (ATOM records): (download)

>d2uv2a1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]}
yehvtrdlnpedfweiigelgdfgkvykaqnketsvlaaakvidtkseeeledymveidi
lascdhpnivklldafyyennlwiliefcaggavdavmlelerpltesqiqvvckqtlda
lnylhdnkiihrdlkagnilftldgdikladfgvsakntrtiqrrdsfigtpywmapevv
mcetskdrpydykadvwslgitliemaeiepphhelnpmrvllkiaksepptlaqpsrws
snfkdflkkcleknvdarwttsqllqhpfvtvdsnkpireliaeak

SCOPe Domain Coordinates for d2uv2a1:

Click to download the PDB-style file with coordinates for d2uv2a1.
(The format of our PDB-style files is described here.)

Timeline for d2uv2a1: