SCOP 1.75: Domain d2uupa3: 2uup A:94-297

Lineage for d2uupa3 (2uup A:94-297)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (2 families)
   has extra strand located between strands 1 and 2

5. Family c.72.2.1: MurCDEF [53624] (4 proteins)

6. Protein UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD [53625] (1 species)

7. Species Escherichia coli [TaxId:562] [53626] (11 PDB entries)

8. Domain d2uupa3: 2uup A:94-297 [152202]
   Other proteins in same PDB: d2uupa1, d2uupa2
   automatically matched to d1e0da3
   complexed with lk4, so4

Details for d2uupa3

PDB Entry: 2uup, 1.88 Å

PDB Description: crystal structure of murd ligase in complex with d-glu containing sulfonamide inhibitor

PDB Compounds: (A:) udp-n-acetylmuramoylalanine--d-glutamate ligase

SCOP Domain Sequences for d2uupa3:

Sequence; same for both SEQRES and ATOM records:

>d2uupa3 c.72.2.1 (A:94-297) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]}
dielfcreaqapivaitgsngkstvttlvgemakaagvnvgvggniglpalmllddecel
yvlelssfqlettsslqavaatilnvtedhmdrypfglqqyraaklriyenakvcvvnad
daltmpirgadercvsfgvnmgdyhlnhqqgetwlrvkgekvlnvkemklsgqhnytnal
aalaladaaglprasslkalttft

Timeline for d2uupa3:

• d2uupa3 is new in SCOP 1.75
  
• d2uupa3 appears in SCOPe 2.01
  
• d2uupa3 appears in the current release, SCOPe 2.08