Lineage for d2lh2__ (2lh2 -)
- Root: SCOP 1.69
Class a: All alpha proteins [46456] (218 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies)
core: 6 helices; folded leaf, partly openedSuperfamily a.1.1: Globin-like [46458] (4 families) 
Family a.1.1.2: Globins [46463] (22 proteins)
Heme-binding protein
Protein Leghemoglobin [46481] (2 species) Species Yellow lupin (Lupinus luteus) [TaxId:3873] [46482] (17 PDB entries) 
Domain d2lh2__: 2lh2 - [15220]
Details for d2lh2__
PDB Entry: 2lh2 (more details), 2 Å
PDB Description: x-ray structural investigation of leghemoglobin. vi. structure of acetate-ferrileghemoglobin at a resolution of 2.0 angstroms (russian)
SCOP Domain Sequences for d2lh2__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lh2__ a.1.1.2 (-) Leghemoglobin {Yellow lupin (Lupinus luteus)}
galtesqaalvkssweefnanipkhthrffilvleiapaakdlfsflkgtsevpqnnpel
qahagkvfklvyeaaiqlevtgvvvtdatlknlgsvhvskgvadahfpvvkeailktike
vvgakwseelnsawtiaydelaivikkemddaa
SCOP Domain Coordinates for d2lh2__:
Click to download the PDB-style file with coordinates for d2lh2__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2lh2__:
- d2lh2__ first appeared (with stable ids) in SCOP 1.55
- d2lh2__ appears in SCOP 1.67
- d2lh2__ appears in SCOP 1.71
- d2lh2__ appears in the current release, SCOPe 2.08, called d2lh2a_
View in 3D