Lineage for d2uuoa3 (2uuo A:94-297)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1385058Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 1385514Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (2 families) (S)
    has extra strand located between strands 1 and 2
  5. 1385515Family c.72.2.1: MurCDEF [53624] (4 proteins)
    automatically mapped to Pfam PF08245
  6. 1385532Protein UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD [53625] (1 species)
  7. 1385533Species Escherichia coli [TaxId:562] [53626] (11 PDB entries)
  8. 1385543Domain d2uuoa3: 2uuo A:94-297 [152199]
    Other proteins in same PDB: d2uuoa1, d2uuoa2
    automatically matched to d1e0da3
    complexed with lk3, so4

Details for d2uuoa3

PDB Entry: 2uuo (more details), 2.5 Å

PDB Description: crystal structure of murd ligase in complex with d-glu containing sulfonamide inhibitor
PDB Compounds: (A:) udp-n-acetylmuramoylalanine--d-glutamate ligase

SCOPe Domain Sequences for d2uuoa3:

Sequence, based on SEQRES records: (download)

>d2uuoa3 c.72.2.1 (A:94-297) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]}
dielfcreaqapivaitgsngkstvttlvgemakaagvnvgvggniglpalmllddecel
yvlelssfqlettsslqavaatilnvtedhmdrypfglqqyraaklriyenakvcvvnad
daltmpirgadercvsfgvnmgdyhlnhqqgetwlrvkgekvlnvkemklsgqhnytnal
aalaladaaglprasslkalttft

Sequence, based on observed residues (ATOM records): (download)

>d2uuoa3 c.72.2.1 (A:94-297) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]}
dielfcreaqapivaitgsngkstvttlvgemakaagvnvgvggniglpalmllddecel
yvlelssfqlettsslqavaatilnvtedhmdrypfglqqyraaklriyenakvcvvnad
daltmprcvsfgvnmgdyhlnhetwlrvkgekvlnvkemklsgqhnytnalaalaladaa
glprasslkalttft

SCOPe Domain Coordinates for d2uuoa3:

Click to download the PDB-style file with coordinates for d2uuoa3.
(The format of our PDB-style files is described here.)

Timeline for d2uuoa3: