Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest |
Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (3 families) |
Family c.59.1.0: automated matches [254241] (1 protein) not a true family |
Protein automated matches [254550] (5 species) not a true protein |
Species Escherichia coli [TaxId:562] [255259] (8 PDB entries) |
Domain d2uuoa2: 2uuo A:298-437 [152198] Other proteins in same PDB: d2uuoa1, d2uuoa3, d2uuoa4 automated match to d4uaga2 complexed with lk3, so4 |
PDB Entry: 2uuo (more details), 2.5 Å
SCOPe Domain Sequences for d2uuoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uuoa2 c.59.1.0 (A:298-437) automated matches {Escherichia coli [TaxId: 562]} glphrfevvlehngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplar ylngdnvrlycfgrdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasld qfknfeqrgnefarlakelg
Timeline for d2uuoa2: