Lineage for d2uuoa1 (2uuo A:1-93)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1833628Fold c.5: MurCD N-terminal domain [51983] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group
  4. 1833629Superfamily c.5.1: MurCD N-terminal domain [51984] (2 families) (S)
  5. 1833651Family c.5.1.0: automated matches [254240] (1 protein)
    not a true family
  6. 1833652Protein automated matches [254548] (3 species)
    not a true protein
  7. 1833653Species Escherichia coli [TaxId:562] [255257] (8 PDB entries)
  8. 1833661Domain d2uuoa1: 2uuo A:1-93 [152197]
    Other proteins in same PDB: d2uuoa2, d2uuoa3
    automated match to d4uaga1
    complexed with lk3, so4

Details for d2uuoa1

PDB Entry: 2uuo (more details), 2.5 Å

PDB Description: crystal structure of murd ligase in complex with d-glu containing sulfonamide inhibitor
PDB Compounds: (A:) udp-n-acetylmuramoylalanine--d-glutamate ligase

SCOPe Domain Sequences for d2uuoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uuoa1 c.5.1.0 (A:1-93) automated matches {Escherichia coli [TaxId: 562]}
adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde
wlmaadlivaspgialahpslsaaadagieivg

SCOPe Domain Coordinates for d2uuoa1:

Click to download the PDB-style file with coordinates for d2uuoa1.
(The format of our PDB-style files is described here.)

Timeline for d2uuoa1: