Lineage for d2uumw1 (2uum W:1-162)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1253685Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1253686Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1255931Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 1255956Protein Phycocyanin alpha subunit [88933] (8 species)
  7. 1255991Species Spirulina sp. [TaxId:1157] [158219] (1 PDB entry)
  8. 1256003Domain d2uumw1: 2uum W:1-162 [152196]
    automatically matched to d1gh0a_
    complexed with bla, cyc

Details for d2uumw1

PDB Entry: 2uum (more details), 3 Å

PDB Description: crystal structure of c-phycocyanin from phormidium, lyngbya spp. (marine) and spirulina sp. (fresh water) shows two different ways of energy transfer between two hexamers.
PDB Compounds: (W:) C-phycocyanin alpha chain

SCOPe Domain Sequences for d2uumw1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uumw1 a.1.1.3 (W:1-162) Phycocyanin alpha subunit {Spirulina sp. [TaxId: 1157]}
mktplteavsvadsqgrflssteiqvafgrfrqakagleaakaltskadslisgaaqavy
nkfpyttqmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagideinr
tfelspswyiealkyikanhglsgdaaveansyldyainals

SCOPe Domain Coordinates for d2uumw1:

Click to download the PDB-style file with coordinates for d2uumw1.
(The format of our PDB-style files is described here.)

Timeline for d2uumw1: