Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore automatically mapped to Pfam PF00502 |
Protein Phycocyanin alpha subunit [88933] (10 species) |
Species Spirulina sp. [TaxId:1157] [158219] (1 PDB entry) |
Domain d2uumq_: 2uum Q: [152193] Other proteins in same PDB: d2uumb_, d2uumd_, d2uumf_, d2uumh_, d2uumj_, d2uuml_, d2uumn_, d2uump_, d2uumr_, d2uumt_, d2uumv_, d2uumx_ automated match to d1gh0a_ complexed with bla, cyc |
PDB Entry: 2uum (more details), 3 Å
SCOPe Domain Sequences for d2uumq_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uumq_ a.1.1.3 (Q:) Phycocyanin alpha subunit {Spirulina sp. [TaxId: 1157]} mktplteavsvadsqgrflssteiqvafgrfrqakagleaakaltskadslisgaaqavy nkfpyttqmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagideinr tfelspswyiealkyikanhglsgdaaveansyldyainals
Timeline for d2uumq_: