Lineage for d2uumk1 (2uum K:1-162)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 759877Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (6 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
  6. 759902Protein Phycocyanin alpha subunit [88933] (7 species)
  7. 759937Species Spirulina sp. [TaxId:1157] [158219] (1 PDB entry)
  8. 759943Domain d2uumk1: 2uum K:1-162 [152190]
    automatically matched to d1gh0a_
    complexed with bla, cyc

Details for d2uumk1

PDB Entry: 2uum (more details), 3 Å

PDB Description: crystal structure of c-phycocyanin from phormidium, lyngbya spp. (marine) and spirulina sp. (fresh water) shows two different ways of energy transfer between two hexamers.
PDB Compounds: (K:) C-phycocyanin alpha chain

SCOP Domain Sequences for d2uumk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uumk1 a.1.1.3 (K:1-162) Phycocyanin alpha subunit {Spirulina sp. [TaxId: 1157]}
mktplteavsvadsqgrflssteiqvafgrfrqakagleaakaltskadslisgaaqavy
nkfpyttqmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagideinr
tfelspswyiealkyikanhglsgdaaveansyldyainals

SCOP Domain Coordinates for d2uumk1:

Click to download the PDB-style file with coordinates for d2uumk1.
(The format of our PDB-style files is described here.)

Timeline for d2uumk1: