![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (4 families) ![]() |
![]() | Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (6 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore |
![]() | Protein Phycocyanin alpha subunit [88933] (7 species) |
![]() | Species Spirulina sp. [TaxId:1157] [158219] (1 PDB entry) |
![]() | Domain d2uumk1: 2uum K:1-162 [152190] automatically matched to d1gh0a_ complexed with bla, cyc |
PDB Entry: 2uum (more details), 3 Å
SCOP Domain Sequences for d2uumk1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uumk1 a.1.1.3 (K:1-162) Phycocyanin alpha subunit {Spirulina sp. [TaxId: 1157]} mktplteavsvadsqgrflssteiqvafgrfrqakagleaakaltskadslisgaaqavy nkfpyttqmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagideinr tfelspswyiealkyikanhglsgdaaveansyldyainals
Timeline for d2uumk1: