| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore automatically mapped to Pfam PF00502 |
| Protein Phycocyanin alpha subunit [88933] (8 species) |
| Species Spirulina sp. [TaxId:1157] [158219] (1 PDB entry) |
| Domain d2uumi1: 2uum I:1-162 [152189] automatically matched to d1gh0a_ complexed with bla, cyc |
PDB Entry: 2uum (more details), 3 Å
SCOPe Domain Sequences for d2uumi1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uumi1 a.1.1.3 (I:1-162) Phycocyanin alpha subunit {Spirulina sp. [TaxId: 1157]}
mktplteavsvadsqgrflssteiqvafgrfrqakagleaakaltskadslisgaaqavy
nkfpyttqmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagideinr
tfelspswyiealkyikanhglsgdaaveansyldyainals
Timeline for d2uumi1: