Lineage for d2uumc_ (2uum C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2688849Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 2688874Protein Phycocyanin alpha subunit [88933] (10 species)
  7. 2688916Species Spirulina sp. [TaxId:1157] [158219] (1 PDB entry)
  8. 2688918Domain d2uumc_: 2uum C: [152186]
    Other proteins in same PDB: d2uumb_, d2uumd_, d2uumf_, d2uumh_, d2uumj_, d2uuml_, d2uumn_, d2uump_, d2uumr_, d2uumt_, d2uumv_, d2uumx_
    automated match to d1gh0a_
    complexed with bla, cyc

Details for d2uumc_

PDB Entry: 2uum (more details), 3 Å

PDB Description: crystal structure of c-phycocyanin from phormidium, lyngbya spp. (marine) and spirulina sp. (fresh water) shows two different ways of energy transfer between two hexamers.
PDB Compounds: (C:) C-phycocyanin alpha chain

SCOPe Domain Sequences for d2uumc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uumc_ a.1.1.3 (C:) Phycocyanin alpha subunit {Spirulina sp. [TaxId: 1157]}
mktplteavsvadsqgrflssteiqvafgrfrqakagleaakaltskadslisgaaqavy
nkfpyttqmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagideinr
tfelspswyiealkyikanhglsgdaaveansyldyainals

SCOPe Domain Coordinates for d2uumc_:

Click to download the PDB-style file with coordinates for d2uumc_.
(The format of our PDB-style files is described here.)

Timeline for d2uumc_: