Lineage for d2lh7__ (2lh7 -)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies) Superfamily a.1.1: Globin-like [46458] (3 families) 
Family a.1.1.2: Globins [46463] (17 proteins) 
Protein Leghemoglobin [46481] (2 species) Species Yellow lupin (Lupinus luteus) [TaxId:3873] [46482] (17 PDB entries) 
Domain d2lh7__: 2lh7 - [15218]
Details for d2lh7__
PDB Entry: 2lh7 (more details), 2 Å
PDB Description: x-ray structural investigation of leghemoglobin. vi. structure of acetate-ferrileghemoglobin at a resolution of 2.0 angstroms (russian)
SCOP Domain Sequences for d2lh7__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lh7__ a.1.1.2 (-) Leghemoglobin {Yellow lupin (Lupinus luteus)}
galtesqaalvkssweefnanipkhthrffilvleiapaakdlfsflkgtsevpqnnpel
qahagkvfklvyeaaiqlevtgvvvtdatlknlgsvhvskgvadahfpvvkeailktike
vvgakwseelnsawtiaydelaivikkemddaa
SCOP Domain Coordinates for d2lh7__:
Click to download the PDB-style file with coordinates for d2lh7__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2lh7__:
- d2lh7__ first appeared (with stable ids) in SCOP 1.55
- d2lh7__ appears in SCOP 1.59
- d2lh7__ appears in the current release, SCOPe 2.08, called d2lh7a_
View in 3D