![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein SUMO-2 [117816] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [117817] (12 PDB entries) Uniprot P61956 |
![]() | Domain d2rpqa1: 2rpq A:15-93 [152179] automatically matched to d2ckhb1 |
PDB Entry: 2rpq (more details)
SCOPe Domain Sequences for d2rpqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rpqa1 d.15.1.1 (A:15-93) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} ndhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtpa qlemededtidvfqqqtgg
Timeline for d2rpqa1: