Lineage for d2rpqa1 (2rpq A:15-93)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1017615Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1017616Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1017617Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1017732Protein SUMO-2 [117816] (1 species)
  7. 1017733Species Human (Homo sapiens) [TaxId:9606] [117817] (9 PDB entries)
    Uniprot P61956
  8. 1017740Domain d2rpqa1: 2rpq A:15-93 [152179]
    automatically matched to d2ckhb1

Details for d2rpqa1

PDB Entry: 2rpq (more details)

PDB Description: solution structure of a sumo-interacting motif of mbd1-containing chromatin-associated factor 1 bound to sumo-3
PDB Compounds: (A:) Small ubiquitin-related modifier 2

SCOPe Domain Sequences for d2rpqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rpqa1 d.15.1.1 (A:15-93) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]}
ndhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtpa
qlemededtidvfqqqtgg

SCOPe Domain Coordinates for d2rpqa1:

Click to download the PDB-style file with coordinates for d2rpqa1.
(The format of our PDB-style files is described here.)

Timeline for d2rpqa1: