Lineage for d2rozb1 (2roz B:1-136)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1323359Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1323360Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1323621Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
    Pfam PF00640
  6. 1323622Protein Amyloid beta A4 precursor protein-binding family B member 2, Apbb2 [117259] (1 species)
  7. 1323623Species Mouse (Mus musculus) [TaxId:10090] [117260] (2 PDB entries)
    Uniprot Q9DBR4 582-704
  8. 1323625Domain d2rozb1: 2roz B:1-136 [152178]
    automatically matched to d1wgua_

Details for d2rozb1

PDB Entry: 2roz (more details)

PDB Description: structure of the c-terminal pid domain of fe65l1 complexed with the cytoplasmic tail of app reveals a novel peptide binding mode
PDB Compounds: (B:) Amyloid beta A4 precursor protein-binding family B member 2

SCOPe Domain Sequences for d2rozb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rozb1 b.55.1.2 (B:1-136) Amyloid beta A4 precursor protein-binding family B member 2, Apbb2 {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgptpktelvqkfrvqylgmlpvdrpvgmdtlnsaienlmtssskedwpsvnmnv
adatvtvisekneeevlvecrvrflsfmgvgkdvhtfafimdtgnqrfechvfwcepnaa
nvseavqaacsgpssg

SCOPe Domain Coordinates for d2rozb1:

Click to download the PDB-style file with coordinates for d2rozb1.
(The format of our PDB-style files is described here.)

Timeline for d2rozb1: