SCOPe 2.04: Domain d2roca_: 2roc A:

Lineage for d2roca_ (2roc A:)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein EAT/MCL-1 (Myeloid cell leukemia sequence 1) [118212] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [118213] (5 PDB entries)
   Uniprot P97287 152-308

8. Domain d2roca_: 2roc A: [152176]
   automated match to d2roda1

Details for d2roca_

PDB Entry: 2roc

PDB Description: solution structure of mcl-1 complexed with puma

PDB Compounds: (A:) Induced myeloid leukemia cell differentiation protein Mcl-1 homolog

SCOPe Domain Sequences for d2roca_:

Sequence; same for both SEQRES and ATOM records:

>d2roca_ f.1.4.1 (A:) EAT/MCL-1 (Myeloid cell leukemia sequence 1) {Mouse (Mus musculus) [TaxId: 10090]}
gplgseddlyrqsleiisrylreqatgskdskplgeagaagrraletlrrvgdgvqrnhe
tafqgmlrkldiknegdvksfsrvmvhvfkdgvtnwgrivtlisfgafvakhlksvnqes
fieplaetitdvlvrtkrdwlvkqrgwdgfveffhvqdlegg

Timeline for d2roca_:

• d2roca_ first appeared in SCOP 1.75, called d2roca1
  
• d2roca_ was called d2roca1 in SCOPe 2.03
  
• d2roca_ appears in SCOPe 2.05
  
• d2roca_ appears in the current release, SCOPe 2.08, called d2roca2