![]() | Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
![]() | Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
![]() | Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (1 family) ![]() PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain |
![]() | Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (10 proteins) Pfam PF00452 |
![]() | Protein EAT/MCL-1 (Myeloid cell leukemia sequence 1) [118212] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [118213] (4 PDB entries) Uniprot P97287 152-308 |
![]() | Domain d2roca1: 2roc A:147-308 [152176] automatically matched to d1wsxa_ mutant |
PDB Entry: 2roc (more details)
SCOP Domain Sequences for d2roca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2roca1 f.1.4.1 (A:147-308) EAT/MCL-1 (Myeloid cell leukemia sequence 1) {Mouse (Mus musculus) [TaxId: 10090]} gplgseddlyrqsleiisrylreqatgskdskplgeagaagrraletlrrvgdgvqrnhe tafqgmlrkldiknegdvksfsrvmvhvfkdgvtnwgrivtlisfgafvakhlksvnqes fieplaetitdvlvrtkrdwlvkqrgwdgfveffhvqdlegg
Timeline for d2roca1: