Lineage for d2roca1 (2roc A:147-308)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 886032Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 886072Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (1 family) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 886073Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (10 proteins)
    Pfam PF00452
  6. 886129Protein EAT/MCL-1 (Myeloid cell leukemia sequence 1) [118212] (1 species)
  7. 886130Species Mouse (Mus musculus) [TaxId:10090] [118213] (4 PDB entries)
    Uniprot P97287 152-308
  8. 886133Domain d2roca1: 2roc A:147-308 [152176]
    automatically matched to d1wsxa_
    mutant

Details for d2roca1

PDB Entry: 2roc (more details)

PDB Description: solution structure of mcl-1 complexed with puma
PDB Compounds: (A:) Induced myeloid leukemia cell differentiation protein Mcl-1 homolog

SCOP Domain Sequences for d2roca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2roca1 f.1.4.1 (A:147-308) EAT/MCL-1 (Myeloid cell leukemia sequence 1) {Mouse (Mus musculus) [TaxId: 10090]}
gplgseddlyrqsleiisrylreqatgskdskplgeagaagrraletlrrvgdgvqrnhe
tafqgmlrkldiknegdvksfsrvmvhvfkdgvtnwgrivtlisfgafvakhlksvnqes
fieplaetitdvlvrtkrdwlvkqrgwdgfveffhvqdlegg

SCOP Domain Coordinates for d2roca1:

Click to download the PDB-style file with coordinates for d2roca1.
(The format of our PDB-style files is described here.)

Timeline for d2roca1: