Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain |
Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins) Pfam PF00452 |
Protein EAT/MCL-1 (Myeloid cell leukemia sequence 1) [118212] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [118213] (6 PDB entries) Uniprot P97287 152-308 |
Domain d2roca2: 2roc A:152-308 [152176] Other proteins in same PDB: d2roca3 automated match to d2roda1 |
PDB Entry: 2roc (more details)
SCOPe Domain Sequences for d2roca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2roca2 f.1.4.1 (A:152-308) EAT/MCL-1 (Myeloid cell leukemia sequence 1) {Mouse (Mus musculus) [TaxId: 10090]} eddlyrqsleiisrylreqatgskdskplgeagaagrraletlrrvgdgvqrnhetafqg mlrkldiknegdvksfsrvmvhvfkdgvtnwgrivtlisfgafvakhlksvnqesfiepl aetitdvlvrtkrdwlvkqrgwdgfveffhvqdlegg
Timeline for d2roca2: