SCOPe 2.05: Domain d2rnya_: 2rny A:

Lineage for d2rnya_ (2rny A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.1: Bromodomain [47371] (5 proteins)

6. Protein CREB-binding protein, CBP [74712] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74713] (7 PDB entries)

8. Domain d2rnya_: 2rny A: [152175]
   automated match to d2rnya1
   protein/DNA complex

Details for d2rnya_

PDB Entry: 2rny

PDB Description: complex structures of cbp bromodomain with h4 ack20 peptide

PDB Compounds: (A:) creb-binding protein

SCOPe Domain Sequences for d2rnya_:

Sequence; same for both SEQRES and ATOM records:

>d2rnya_ a.29.2.1 (A:) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]}
gshmrkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdls
tikrkldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqsl
g

Timeline for d2rnya_:

• d2rnya_ first appeared in SCOP 1.75, called d2rnya1
  
• d2rnya_ appears in SCOPe 2.04
  
• d2rnya_ is called d2rnya2 in SCOPe 2.06
  
• d2rnya_ appears in the current release, SCOPe 2.08, called d2rnya2