Lineage for d2rnxa2 (2rnx A:719-832)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706695Family a.29.2.1: Bromodomain [47371] (6 proteins)
  6. 2706796Protein P300/CAF histone acetyltransferase bromodomain [47375] (1 species)
  7. 2706797Species Human (Homo sapiens) [TaxId:9606] [47376] (8 PDB entries)
  8. 2706804Domain d2rnxa2: 2rnx A:719-832 [152174]
    Other proteins in same PDB: d2rnxa3
    automated match to d2rnxa1
    protein/DNA complex

Details for d2rnxa2

PDB Entry: 2rnx (more details)

PDB Description: the structural basis for site-specific lysine-acetylated histone recognition by the bromodomains of the human transcriptional co- activators pcaf and cbp
PDB Compounds: (A:) Histone acetyltransferase PCAF

SCOPe Domain Sequences for d2rnxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rnxa2 a.29.2.1 (A:719-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]}
skeprdpdqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlktmserlk
nryyvskklfmadlqrvftnckeynppeseyykcanilekfffskikeaglidk

SCOPe Domain Coordinates for d2rnxa2:

Click to download the PDB-style file with coordinates for d2rnxa2.
(The format of our PDB-style files is described here.)

Timeline for d2rnxa2: