Lineage for d2rnrb_ (2rnr B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1798838Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1798839Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1799354Family b.55.1.9: TFIIH domain [110272] (2 proteins)
  6. 1799366Protein TFIIH basal transcription factor complex p62 subunit (BTF2-p62), N-terminal domain [110273] (1 species)
  7. 1799367Species Human (Homo sapiens) [TaxId:9606] [110274] (4 PDB entries)
    Uniprot P32780 1-108
  8. 1799369Domain d2rnrb_: 2rnr B: [152172]
    automated match to d2rnrb1
    protein/DNA complex

Details for d2rnrb_

PDB Entry: 2rnr (more details)

PDB Description: solution structure of the complex between tfiie alpha c-terminal acidic domain and tfiih p62 ph domain
PDB Compounds: (B:) TFIIH basal transcription factor complex p62 subunit

SCOPe Domain Sequences for d2rnrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rnrb_ b.55.1.9 (B:) TFIIH basal transcription factor complex p62 subunit (BTF2-p62), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
matsseevllivkkvrqkkqdgalylmaeriawapegkdrftishmyadikcqkispegk
akiqlqlvlhagdttnfhfsnestavkerdavkdllqqllpkfkrkan

SCOPe Domain Coordinates for d2rnrb_:

Click to download the PDB-style file with coordinates for d2rnrb_.
(The format of our PDB-style files is described here.)

Timeline for d2rnrb_: