Lineage for d2lh1a_ (2lh1 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2301283Protein Leghemoglobin [46481] (2 species)
  7. 2301289Species Yellow lupine (Lupinus luteus) [TaxId:3873] [46482] (17 PDB entries)
  8. 2301290Domain d2lh1a_: 2lh1 A: [15217]
    complexed with act, hem

Details for d2lh1a_

PDB Entry: 2lh1 (more details), 2 Å

PDB Description: x-ray structural investigation of leghemoglobin. vi. structure of acetate-ferrileghemoglobin at a resolution of 2.0 angstroms (russian)
PDB Compounds: (A:) leghemoglobin (aceto met)

SCOPe Domain Sequences for d2lh1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lh1a_ a.1.1.2 (A:) Leghemoglobin {Yellow lupine (Lupinus luteus) [TaxId: 3873]}
galtesqaalvkssweefnanipkhthrffilvleiapaakdlfsflkgtsevpqnnpel
qahagkvfklvyeaaiqlevtgvvvtdatlknlgsvhvskgvadahfpvvkeailktike
vvgakwseelnsawtiaydelaivikkemddaa

SCOPe Domain Coordinates for d2lh1a_:

Click to download the PDB-style file with coordinates for d2lh1a_.
(The format of our PDB-style files is described here.)

Timeline for d2lh1a_: