Lineage for d2rmkb_ (2rmk B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1718782Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1718974Superfamily a.2.6: HR1 repeat [46585] (1 family) (S)
  5. 1718975Family a.2.6.1: HR1 repeat [46586] (2 proteins)
    protein kinase effector domain
    this is a repeat family; one repeat unit is 1urf A:122-199 found in domain
  6. 1718976Protein Protein kinase c-like 1, pkn/prk1 [46587] (1 species)
  7. 1718977Species Human (Homo sapiens) [TaxId:9606] [46588] (3 PDB entries)
  8. 1718980Domain d2rmkb_: 2rmk B: [152167]
    Other proteins in same PDB: d2rmka_
    automated match to d1urfa_
    complexed with gcp, mg

Details for d2rmkb_

PDB Entry: 2rmk (more details)

PDB Description: rac1/prk1 complex
PDB Compounds: (B:) Serine/threonine-protein kinase N1

SCOPe Domain Sequences for d2rmkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rmkb_ a.2.6.1 (B:) Protein kinase c-like 1, pkn/prk1 {Human (Homo sapiens) [TaxId: 9606]}
gipatnlsrvaglekqlaielkvkqgaenmiqtysngstkdrkllltaqqmlqdsktkid
iirmqlrralqadqlenqaap

SCOPe Domain Coordinates for d2rmkb_:

Click to download the PDB-style file with coordinates for d2rmkb_.
(The format of our PDB-style files is described here.)

Timeline for d2rmkb_: