Lineage for d2rmkb1 (2rmk B:119-199)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 760084Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 760238Superfamily a.2.6: HR1 repeat [46585] (1 family) (S)
  5. 760239Family a.2.6.1: HR1 repeat [46586] (1 protein)
    protein kinase effector domain
    this is a repeat family; one repeat unit is 1urf A:122-199 found in domain
  6. 760240Protein Protein kinase c-like 1, pkn/prk1 [46587] (1 species)
  7. 760241Species Human (Homo sapiens) [TaxId:9606] [46588] (3 PDB entries)
  8. 760244Domain d2rmkb1: 2rmk B:119-199 [152167]
    Other proteins in same PDB: d2rmka1
    automatically matched to d1urfa_
    complexed with gcp, mg; mutant

Details for d2rmkb1

PDB Entry: 2rmk (more details)

PDB Description: rac1/prk1 complex
PDB Compounds: (B:) Serine/threonine-protein kinase N1

SCOP Domain Sequences for d2rmkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rmkb1 a.2.6.1 (B:119-199) Protein kinase c-like 1, pkn/prk1 {Human (Homo sapiens) [TaxId: 9606]}
gipatnlsrvaglekqlaielkvkqgaenmiqtysngstkdrkllltaqqmlqdsktkid
iirmqlrralqadqlenqaap

SCOP Domain Coordinates for d2rmkb1:

Click to download the PDB-style file with coordinates for d2rmkb1.
(The format of our PDB-style files is described here.)

Timeline for d2rmkb1: