Class a: All alpha proteins [46456] (284 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.6: HR1 repeat [46585] (1 family) |
Family a.2.6.1: HR1 repeat [46586] (1 protein) protein kinase effector domain this is a repeat family; one repeat unit is 1urf A:122-199 found in domain |
Protein Protein kinase c-like 1, pkn/prk1 [46587] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [46588] (3 PDB entries) |
Domain d2rmkb1: 2rmk B:119-199 [152167] Other proteins in same PDB: d2rmka1 automatically matched to d1urfa_ complexed with gcp, mg; mutant |
PDB Entry: 2rmk (more details)
SCOP Domain Sequences for d2rmkb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rmkb1 a.2.6.1 (B:119-199) Protein kinase c-like 1, pkn/prk1 {Human (Homo sapiens) [TaxId: 9606]} gipatnlsrvaglekqlaielkvkqgaenmiqtysngstkdrkllltaqqmlqdsktkid iirmqlrralqadqlenqaap
Timeline for d2rmkb1: