![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.6: HR1 repeat [46585] (1 family) ![]() |
![]() | Family a.2.6.1: HR1 repeat [46586] (2 proteins) protein kinase effector domain this is a repeat family; one repeat unit is 1urf A:122-199 found in domain |
![]() | Protein Protein kinase c-like 1, pkn/prk1 [46587] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [46588] (3 PDB entries) |
![]() | Domain d2rmkb2: 2rmk B:122-199 [152167] Other proteins in same PDB: d2rmka_, d2rmkb3 automated match to d1urfa_ complexed with gcp, mg |
PDB Entry: 2rmk (more details)
SCOPe Domain Sequences for d2rmkb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rmkb2 a.2.6.1 (B:122-199) Protein kinase c-like 1, pkn/prk1 {Human (Homo sapiens) [TaxId: 9606]} atnlsrvaglekqlaielkvkqgaenmiqtysngstkdrkllltaqqmlqdsktkidiir mqlrralqadqlenqaap
Timeline for d2rmkb2: