SCOPe 2.08: Domain d2rmkb2: 2rmk B:122-199

Lineage for d2rmkb2 (2rmk B:122-199)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.6: HR1 repeat [46585] (1 family)

5. Family a.2.6.1: HR1 repeat [46586] (2 proteins)
   protein kinase effector domain
   this is a repeat family; one repeat unit is 1urf A:122-199 found in domain

6. Protein Protein kinase c-like 1, pkn/prk1 [46587] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46588] (3 PDB entries)

8. Domain d2rmkb2: 2rmk B:122-199 [152167]
   Other proteins in same PDB: d2rmka_, d2rmkb3
   automated match to d1urfa_
   complexed with gcp, mg

Details for d2rmkb2

PDB Entry: 2rmk

PDB Description: rac1/prk1 complex

PDB Compounds: (B:) Serine/threonine-protein kinase N1

SCOPe Domain Sequences for d2rmkb2:

Sequence; same for both SEQRES and ATOM records:

>d2rmkb2 a.2.6.1 (B:122-199) Protein kinase c-like 1, pkn/prk1 {Human (Homo sapiens) [TaxId: 9606]}
atnlsrvaglekqlaielkvkqgaenmiqtysngstkdrkllltaqqmlqdsktkidiir
mqlrralqadqlenqaap

Timeline for d2rmkb2:

• d2rmkb2 first appeared in SCOP 1.75, called d2rmkb1
  
• d2rmkb2 appears in SCOPe 2.07