SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2rmka_ (2rmk A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2110099Family c.37.1.8: G proteins [52592] (79 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2110798Protein Rac [52595] (1 species)
  7. 2110799Species Human (Homo sapiens) [TaxId:9606] [52596] (17 PDB entries)
  8. 2110826Domain d2rmka_: 2rmk A: [152166]
    Other proteins in same PDB: d2rmkb2, d2rmkb3
    automated match to d2yind_
    complexed with gcp, mg

Details for d2rmka_

PDB Entry: 2rmk (more details)

PDB Description: Rac1/PRK1 Complex
PDB Compounds: (A:) ras-related c3 botulinum toxin substrate 1

SCOPe Domain Sequences for d2rmka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rmka_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]}
mqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
ledydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlcpp
pvkkrkrkclll

SCOPe Domain Coordinates for d2rmka_:

Click to download the PDB-style file with coordinates for d2rmka_.
(The format of our PDB-style files is described here.)

Timeline for d2rmka_: