SCOP 1.71: Domain d1gdl__: 1gdl -

Lineage for d1gdl__ (1gdl -)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Leghemoglobin [46481] (2 species)

7. Species Yellow lupin (Lupinus luteus) [TaxId:3873] [46482] (17 PDB entries)

8. Domain d1gdl__: 1gdl - [15216]
   complexed with hem, nmo

Details for d1gdl__

PDB Entry: 1gdl, 1.8 Å

PDB Description: crystal structure of ferric complexes of the yellow lupin leghemoglobin with isoquinoline at 1.8 angstroms resolution (russian)

SCOP Domain Sequences for d1gdl__:

Sequence; same for both SEQRES and ATOM records:

>d1gdl__ a.1.1.2 (-) Leghemoglobin {Yellow lupin (Lupinus luteus)}
galtesqaalvkssweefnanipkhthrffilvleiapaakdlfsflkgtsevpqnnpel
qahagkvfklvyeaaiqlevtgvvvtdatlknlgsvhvskgvadahfpvvkeailktike
vvgakwseelnsawtiaydelaivikkemddaa

Timeline for d1gdl__:

• d1gdl__ first appeared (with stable ids) in SCOP 1.55
  
• d1gdl__ appears in SCOP 1.69
  
• d1gdl__ is called d1gdla_ in SCOP 1.73
  
• d1gdl__ appears in the current release, SCOPe 2.08, called d1gdla_