Lineage for d1gdla_ (1gdl A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2301102Protein Leghemoglobin [46481] (2 species)
  7. 2301108Species Yellow lupine (Lupinus luteus) [TaxId:3873] [46482] (17 PDB entries)
  8. 2301123Domain d1gdla_: 1gdl A: [15216]
    complexed with hem, no

Details for d1gdla_

PDB Entry: 1gdl (more details), 1.8 Å

PDB Description: crystal structure of ferric complexes of the yellow lupin leghemoglobin with isoquinoline at 1.8 angstroms resolution (russian)
PDB Compounds: (A:) leghemoglobin (nitrogen monoxy)

SCOPe Domain Sequences for d1gdla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gdla_ a.1.1.2 (A:) Leghemoglobin {Yellow lupine (Lupinus luteus) [TaxId: 3873]}
galtesqaalvkssweefnanipkhthrffilvleiapaakdlfsflkgtsevpqnnpel
qahagkvfklvyeaaiqlevtgvvvtdatlknlgsvhvskgvadahfpvvkeailktike
vvgakwseelnsawtiaydelaivikkemddaa

SCOPe Domain Coordinates for d1gdla_:

Click to download the PDB-style file with coordinates for d1gdla_.
(The format of our PDB-style files is described here.)

Timeline for d1gdla_: