Lineage for d2rlta_ (2rlt A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735748Fold a.165: Myosin phosphatase inhibitor 17kDa protein, CPI-17 [81789] (1 superfamily)
    4 helices; open up-and-down bundle; flexible N-terminal tail
  4. 2735749Superfamily a.165.1: Myosin phosphatase inhibitor 17kDa protein, CPI-17 [81790] (1 family) (S)
    automatically mapped to Pfam PF05361
  5. 2735750Family a.165.1.1: Myosin phosphatase inhibitor 17kDa protein, CPI-17 [81791] (1 protein)
  6. 2735751Protein Myosin phosphatase inhibitor 17kDa protein, CPI-17 [81792] (1 species)
  7. 2735752Species Pig (Sus scrofa) [TaxId:9823] [81793] (4 PDB entries)
  8. 2735755Domain d2rlta_: 2rlt A: [152157]
    automated match to d1j2ma_

Details for d2rlta_

PDB Entry: 2rlt (more details)

PDB Description: phosphorylated cpi-17 (22-120)
PDB Compounds: (A:) Protein phosphatase 1 regulatory subunit 14A

SCOPe Domain Sequences for d2rlta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rlta_ a.165.1.1 (A:) Myosin phosphatase inhibitor 17kDa protein, CPI-17 {Pig (Sus scrofa) [TaxId: 9823]}
gpggspgglqkrharvtvkydrrelqrrldvekwidgrleelyrgreadmpdevnidell
eleseeersrkiqgllksctnptenfvqellvklrglhk

SCOPe Domain Coordinates for d2rlta_:

Click to download the PDB-style file with coordinates for d2rlta_.
(The format of our PDB-style files is described here.)

Timeline for d2rlta_: