Lineage for d2rlka1 (2rlk A:1-36)

  1. Root: SCOPe 2.03
  2. 1470528Class j: Peptides [58231] (120 folds)
  3. 1470747Fold j.6: Peptide hormones [58283] (1 superfamily)
    contains one alpha-helix
  4. 1470748Superfamily j.6.1: Peptide hormones [58284] (1 family) (S)
    this is not a true superfamily
  5. 1470749Family j.6.1.1: Peptide hormones [58285] (19 proteins)
  6. 1470829Protein Peptide YY, PYY [58292] (2 species)
  7. 1470833Species Pig (Sus scrofa) [TaxId:9823] [58293] (6 PDB entries)
    Uniprot P68005
  8. 1470834Domain d2rlka1: 2rlk A:1-36 [152156]
    automatically matched to d1qbfa_

Details for d2rlka1

PDB Entry: 2rlk (more details)

PDB Description: refined solution structure of porcine peptide yy (pyy)
PDB Compounds: (A:) Peptide YY

SCOPe Domain Sequences for d2rlka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rlka1 j.6.1.1 (A:1-36) Peptide YY, PYY {Pig (Sus scrofa) [TaxId: 9823]}
ypakpeapgedaspeelsryyaslrhylnlvtrqry

SCOPe Domain Coordinates for d2rlka1:

Click to download the PDB-style file with coordinates for d2rlka1.
(The format of our PDB-style files is described here.)

Timeline for d2rlka1: