![]() | Class j: Peptides [58231] (120 folds) |
![]() | Fold j.6: Peptide hormones [58283] (1 superfamily) contains one alpha-helix |
![]() | Superfamily j.6.1: Peptide hormones [58284] (1 family) ![]() this is not a true superfamily |
![]() | Family j.6.1.1: Peptide hormones [58285] (19 proteins) |
![]() | Protein Peptide YY, PYY [58292] (2 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [58293] (6 PDB entries) Uniprot P68005 |
![]() | Domain d2rlka1: 2rlk A:1-36 [152156] automatically matched to d1qbfa_ |
PDB Entry: 2rlk (more details)
SCOPe Domain Sequences for d2rlka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rlka1 j.6.1.1 (A:1-36) Peptide YY, PYY {Pig (Sus scrofa) [TaxId: 9823]} ypakpeapgedaspeelsryyaslrhylnlvtrqry
Timeline for d2rlka1: