Lineage for d2rldc_ (2rld C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2709022Superfamily a.29.16: IVS-encoded protein-like [158446] (1 family) (S)
    IVS: Intervening sequence with conserved ORF in eubacterial 23S rRNA genes; forms a homopentamer with a toroid-shaped structure containing a tapered central channel
    automatically mapped to Pfam PF05635
  5. 2709023Family a.29.16.1: IVS-encoded protein-like [158447] (3 proteins)
    Pfam PF05635
  6. 2709024Protein Uncharacterized protein BT0352 [158450] (1 species)
  7. 2709025Species Bacteroides thetaiotaomicron [TaxId:818] [158451] (1 PDB entry)
    Uniprot Q8AAW0 1-115
  8. 2709028Domain d2rldc_: 2rld C: [152152]
    Other proteins in same PDB: d2rlda2
    automated match to d2rlda1
    complexed with ca, cl, edo

Details for d2rldc_

PDB Entry: 2rld (more details), 1.7 Å

PDB Description: crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution
PDB Compounds: (C:) Uncharacterized protein

SCOPe Domain Sequences for d2rldc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rldc_ a.29.16.1 (C:) Uncharacterized protein BT0352 {Bacteroides thetaiotaomicron [TaxId: 818]}
mredmkdnvvkdkslefavrivnlykflvneqkefvmskqilrsgtsiganireaeqaqs
radfinklnialkeaneteywlellirteyitreqyesinndsteinkllisiikt

SCOPe Domain Coordinates for d2rldc_:

Click to download the PDB-style file with coordinates for d2rldc_.
(The format of our PDB-style files is described here.)

Timeline for d2rldc_: