![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.16: IVS-encoded protein-like [158446] (1 family) ![]() IVS: Intervening sequence with conserved ORF in eubacterial 23S rRNA genes; forms a homopentamer with a toroid-shaped structure containing a tapered central channel automatically mapped to Pfam PF05635 |
![]() | Family a.29.16.1: IVS-encoded protein-like [158447] (3 proteins) Pfam PF05635 |
![]() | Protein Uncharacterized protein BT0352 [158450] (1 species) |
![]() | Species Bacteroides thetaiotaomicron [TaxId:818] [158451] (1 PDB entry) Uniprot Q8AAW0 1-115 |
![]() | Domain d2rldb_: 2rld B: [152151] Other proteins in same PDB: d2rlda2 automated match to d2rlda1 complexed with ca, cl, edo |
PDB Entry: 2rld (more details), 1.7 Å
SCOPe Domain Sequences for d2rldb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rldb_ a.29.16.1 (B:) Uncharacterized protein BT0352 {Bacteroides thetaiotaomicron [TaxId: 818]} mkdnvvkdkslefavrivnlykflvneqkefvmskqilrsgtsiganireaeqaqsradf inklnialkeaneteywlellirteyitreqyesinndsteinkllisiikt
Timeline for d2rldb_: