Lineage for d2rlda1 (2rld A:1-115)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2709022Superfamily a.29.16: IVS-encoded protein-like [158446] (1 family) (S)
    IVS: Intervening sequence with conserved ORF in eubacterial 23S rRNA genes; forms a homopentamer with a toroid-shaped structure containing a tapered central channel
    automatically mapped to Pfam PF05635
  5. 2709023Family a.29.16.1: IVS-encoded protein-like [158447] (3 proteins)
    Pfam PF05635
  6. 2709024Protein Uncharacterized protein BT0352 [158450] (1 species)
  7. 2709025Species Bacteroides thetaiotaomicron [TaxId:818] [158451] (1 PDB entry)
    Uniprot Q8AAW0 1-115
  8. 2709026Domain d2rlda1: 2rld A:1-115 [152150]
    Other proteins in same PDB: d2rlda2
    complexed with ca, cl, edo

Details for d2rlda1

PDB Entry: 2rld (more details), 1.7 Å

PDB Description: crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution
PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d2rlda1:

Sequence, based on SEQRES records: (download)

>d2rlda1 a.29.16.1 (A:1-115) Uncharacterized protein BT0352 {Bacteroides thetaiotaomicron [TaxId: 818]}
mredmkdnvvkdkslefavrivnlykflvneqkefvmskqilrsgtsiganireaeqaqs
radfinklnialkeaneteywlellirteyitreqyesinndsteinkllisiik

Sequence, based on observed residues (ATOM records): (download)

>d2rlda1 a.29.16.1 (A:1-115) Uncharacterized protein BT0352 {Bacteroides thetaiotaomicron [TaxId: 818]}
mredmkdnvvkdkslefavrivnlykflvneqkefvmskqilrsgtsiganireaeqsra
dfinklnialkeaneteywlellirteyitreqyesinndsteinkllisiik

SCOPe Domain Coordinates for d2rlda1:

Click to download the PDB-style file with coordinates for d2rlda1.
(The format of our PDB-style files is described here.)

Timeline for d2rlda1: